PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049309
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24755.3 Da    PI: 9.3262
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049309genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.21.1e-281059251
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          +ienk+nrqvtfskRr g+ KKA+E+SvLCdaeva+i+fs++gk++eyss
  PGSC0003DMP400049309 10 KIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSQKGKIFEYSS 59
                          69**********************************************96 PP

2K-box106.14.3e-35851769100
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                            e+  +e+++ e++kLk++i+ Lqr+++h++GedL+s+slk+Lq+LeqqL+++lk iRs+Kn+l++e+i+elqkke+++ een++L+kk
  PGSC0003DMP400049309  85 SESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMSLKDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKK 173
                           5667789********************************************************************************** PP

                 K-box  98 lee 100
                           ++e
  PGSC0003DMP400049309 174 IKE 176
                           987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-39160IPR002100Transcription factor, MADS-box
CDDcd002658.49E-40276No hitNo description
SuperFamilySSF554554.97E-34288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-30323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.6E-3185174IPR002487Transcription factor, K-box
PROSITE profilePS5129717.44390180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRGKVELRK IENKINRQVT FSKRRGGLVK KAHEISVLCD AEVALIVFSQ KGKIFEYSSD  60
SCMEQILERY ERYSYAERRL LANNSESPVQ ENWSLEYTKL KARIDLLQRN HKHYMGEDLD  120
SMSLKDLQNL EQQLDSALKL IRSRKNQLMH ESISELQKKE RAILEENNML TKKIKEKDKI  180
VEQQGEWHQQ TNQVSTSTSF LLQPHQCLNM G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174173Myocyte-specific enhancer factor 2B
1tqe_R2e-20174173Myocyte-specific enhancer factor 2B
1tqe_S2e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4148590.0KC414859.1 Solanum tuberosum MC mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234665.11e-154MADS-box transcription factor MADS-MC
SwissprotQ424291e-100AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CR491e-155M1CR49_SOLTU; Uncharacterized protein
TrEMBLM1CR501e-154M1CR50_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000728881e-154(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.15e-85MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]